SLC12A1 Antikörper

Produktnummer ABIN632379

Produktdetails anti-SLC12A1 Antikörper

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Reaktivität: Ratte, Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC12A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: SLC12 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC12A1 Blocking Peptide, catalog no. 33R-6671, is also available for use as a blocking control in assays to test for specificity of this SLC12A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC12A1

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Andere Bezeichnung: SLC12A1 (SLC12A1 Produkte)

Synonyme: slc12a1 antikoerper, SLC12A1 antikoerper, DKFZp469A2020 antikoerper, BSC1 antikoerper, NKCC2 antikoerper, Nkcc2 antikoerper, AI788571 antikoerper, D630042G03Rik antikoerper, mBSC1 antikoerper, urehr3 antikoerper, si:ch211-220f12.1 antikoerper, solute carrier family 12 member 1 antikoerper, solute carrier family 12, member 1 antikoerper, si:ch211-220f12.1 antikoerper, SLC12A1 antikoerper, Slc12a1 antikoerper

Hintergrund: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Molekulargewicht: 47 kDa (MW of target protein)