ETF1 Antikörper (N-Term)
-
- Target Alle ETF1 Antikörper anzeigen
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ETF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ETF1 antibody was raised against the N terminal of ETF1
- Aufreinigung
- Affinity purified
- Immunogen
- ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
- Top Product
- Discover our top product ETF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
- Andere Bezeichnung
- ETF1 (ETF1 Produkte)
- Synonyme
- D5S1995 antikoerper, ERF antikoerper, ERF1 antikoerper, RF1 antikoerper, SUP45L1 antikoerper, TB3-1 antikoerper, AI463371 antikoerper, D6Ertd109e antikoerper, eRF1 antikoerper, zeh0057 antikoerper, hm:zeh0057 antikoerper, wu:fa19e07 antikoerper, wu:fi31f01 antikoerper, cl1 antikoerper, RRF1 antikoerper, DDBDRAFT_0188023 antikoerper, DDBDRAFT_0191343 antikoerper, DDB_0188023 antikoerper, DDB_0191343 antikoerper, CG5605 antikoerper, Dm0184 antikoerper, Dmel\\CG5605 antikoerper, Group J antikoerper, group J antikoerper, l(3)00103 antikoerper, l(3)05637 antikoerper, l(3)77ABb antikoerper, l(3)neo28 antikoerper, Eukaryotic release factor 1 antikoerper, eukaryotic translation termination factor 1 antikoerper, eukaryotic translation termination factor 1b antikoerper, eukaryotic translation termination factor 1 S homeolog antikoerper, eukaryotic peptide chain release factor subunit 1 antikoerper, eukaryotic petide chain release factor subunit 1 antikoerper, eukaryotic release factor 1 antikoerper, Eukaryotic peptide chain release factor subunit 1 antikoerper, ETF1 antikoerper, Etf1 antikoerper, etf1b antikoerper, etf1 antikoerper, etf1.S antikoerper, Tb11.22.0012 antikoerper, THAPSDRAFT_22240 antikoerper, TTHERM_00292170 antikoerper, LOC692937 antikoerper, erf1 antikoerper, eRF1 antikoerper, erfa-1 antikoerper
- Hintergrund
- Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.
- Molekulargewicht
- 49 kDa (MW of target protein)
-