ETF1 Antikörper (N-Term)

Produktnummer ABIN632229

Produktdetails anti-ETF1 Antikörper

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ETF1 antibody was raised against the N terminal of ETF1

Aufreinigung: Affinity purified

Immunogen: ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ETF1

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Andere Bezeichnung: ETF1 (ETF1 Produkte)

Synonyme: D5S1995 antikoerper, ERF antikoerper, ERF1 antikoerper, RF1 antikoerper, SUP45L1 antikoerper, TB3-1 antikoerper, AI463371 antikoerper, D6Ertd109e antikoerper, eRF1 antikoerper, zeh0057 antikoerper, hm:zeh0057 antikoerper, wu:fa19e07 antikoerper, wu:fi31f01 antikoerper, cl1 antikoerper, RRF1 antikoerper, DDBDRAFT_0188023 antikoerper, DDBDRAFT_0191343 antikoerper, DDB_0188023 antikoerper, DDB_0191343 antikoerper, CG5605 antikoerper, Dm0184 antikoerper, Dmel\\CG5605 antikoerper, Group J antikoerper, group J antikoerper, l(3)00103 antikoerper, l(3)05637 antikoerper, l(3)77ABb antikoerper, l(3)neo28 antikoerper, Eukaryotic release factor 1 antikoerper, eukaryotic translation termination factor 1 antikoerper, eukaryotic translation termination factor 1b antikoerper, eukaryotic translation termination factor 1 S homeolog antikoerper, eukaryotic peptide chain release factor subunit 1 antikoerper, eukaryotic petide chain release factor subunit 1 antikoerper, eukaryotic release factor 1 antikoerper, Eukaryotic peptide chain release factor subunit 1 antikoerper, ETF1 antikoerper, Etf1 antikoerper, etf1b antikoerper, etf1 antikoerper, etf1.S antikoerper, Tb11.22.0012 antikoerper, THAPSDRAFT_22240 antikoerper, TTHERM_00292170 antikoerper, LOC692937 antikoerper, erf1 antikoerper, eRF1 antikoerper, erfa-1 antikoerper

Hintergrund: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Molekulargewicht: 49 kDa (MW of target protein)