Calpain S1 Antikörper (Middle Region)

Produktnummer ABIN632073

Produktdetails anti-Calpain S1 Antikörper

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calpain S1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Calpain 4 antibody was raised against the middle region of CAPNS1

Aufreinigung: Affinity purified

Immunogen: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calpain S1

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Andere Bezeichnung: Calpain 4 (CAPNS1 Produkte)

Synonyme: 30K antikoerper, CALPAIN4 antikoerper, CANP antikoerper, CANPS antikoerper, CAPN4 antikoerper, CDPS antikoerper, CSS1 antikoerper, Capn4 antikoerper, CAPNS1 antikoerper, Capa-4 antikoerper, Capa4 antikoerper, D7Ertd146e antikoerper, MGC84330 antikoerper, capns1 antikoerper, cb616 antikoerper, wu:fb81g08 antikoerper, wu:fl09e04 antikoerper, zgc:110603 antikoerper, calpain small subunit 1 antikoerper, calpain, small subunit 1 antikoerper, calpain, small subunit 1 L homeolog antikoerper, calpain, small subunit 1 a antikoerper, CAPNS1 antikoerper, Capns1 antikoerper, capns1.L antikoerper, capns1a antikoerper

Hintergrund: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Apoptose