Calpain S1 Antikörper (Middle Region)

Produktnummer ABIN632073

Der Kaninchen Polyklonal anti-Calpain S1 Antikörper (ABIN632073) detektiert spezifisch Calpain S1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Calpain S1 Antikörper (Middle Region) (ABIN632073)

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calpain S1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calpain S1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Calpain 4 antibody was raised against the middle region of CAPNS1

Aufreinigung: Affinity purified

Immunogen: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calpain 4 Blocking Peptide, (ABIN5612585), is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calpain S1

Target: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Andere Bezeichnung: Calpain 4

Hintergrund: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Apoptose