Calpain S1 Antikörper (Middle Region)
-
- Target Alle Calpain S1 (CAPNS1) Antikörper anzeigen
- Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calpain S1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calpain 4 antibody was raised against the middle region of CAPNS1
- Aufreinigung
- Affinity purified
- Immunogen
- Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
- Top Product
- Discover our top product CAPNS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))
- Andere Bezeichnung
- Calpain 4 (CAPNS1 Produkte)
- Synonyme
- 30K antikoerper, CALPAIN4 antikoerper, CANP antikoerper, CANPS antikoerper, CAPN4 antikoerper, CDPS antikoerper, CSS1 antikoerper, Capn4 antikoerper, CAPNS1 antikoerper, Capa-4 antikoerper, Capa4 antikoerper, D7Ertd146e antikoerper, MGC84330 antikoerper, capns1 antikoerper, cb616 antikoerper, wu:fb81g08 antikoerper, wu:fl09e04 antikoerper, zgc:110603 antikoerper, calpain small subunit 1 antikoerper, calpain, small subunit 1 antikoerper, calpain, small subunit 1 L homeolog antikoerper, calpain, small subunit 1 a antikoerper, CAPNS1 antikoerper, Capns1 antikoerper, capns1.L antikoerper, capns1a antikoerper
- Hintergrund
- Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Apoptose
-