GNB1 Antikörper
-
- Target Alle GNB1 Antikörper anzeigen
- GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
- Top Product
- Discover our top product GNB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNB1 Blocking Peptide, catalog no. 33R-2064, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))
- Andere Bezeichnung
- GNB1 (GNB1 Produkte)
- Synonyme
- gnb1 antikoerper, wu:fb50b09 antikoerper, wu:fj94h04 antikoerper, AA409223 antikoerper, C77571 antikoerper, Gnb-1 antikoerper, XGB1 antikoerper, xgbeta1 antikoerper, GNB1x antikoerper, fb39f01 antikoerper, gnb1l antikoerper, wu:fb39f01 antikoerper, wu:fb98e06 antikoerper, wu:fj09d12 antikoerper, zgc:55774 antikoerper, G protein subunit beta 1 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1a antikoerper, guanine nucleotide binding protein (G protein), beta 1 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1 S homeolog antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1b antikoerper, GNB1 antikoerper, gnb1a antikoerper, Gnb1 antikoerper, gnb1.S antikoerper, gnb1b antikoerper
- Hintergrund
- Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interaktom
-