ARPC3 Antikörper (N-Term)

Produktnummer ABIN631647

Produktdetails anti-ARPC3 Antikörper

Target: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARPC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARPC3 antibody was raised against the N terminal of ARPC3

Aufreinigung: Affinity purified

Immunogen: ARPC3 antibody was raised using the N terminal of ARPC3 corresponding to a region with amino acids MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARPC3 Blocking Peptide, catalog no. 33R-6271, is also available for use as a blocking control in assays to test for specificity of this ARPC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARPC3

Target: ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))

Andere Bezeichnung: ARPC3 (ARPC3 Produkte)

Synonyme: ARC21 antikoerper, p21-Arc antikoerper, 1110006A04Rik antikoerper, 21kDa antikoerper, AA408672 antikoerper, AI788639 antikoerper, p21-Ar antikoerper, p21Arc antikoerper, arc21 antikoerper, p21-arc antikoerper, zgc:86828 antikoerper, actin related protein 2/3 complex subunit 3 antikoerper, actin related protein 2/3 complex, subunit 3 antikoerper, actin related protein 2/3 complex subunit 3 L homeolog antikoerper, actin related protein 2/3 complex, subunit 3, 21kDa antikoerper, actin related protein 2/3 complex subunit 3 pseudogene antikoerper, actin-related protein 2/3 complex subunit 3 antikoerper, actin-related protein 2/3 complex subunit 3 pseudogene antikoerper, ARPC3 antikoerper, Arpc3 antikoerper, arpc3.L antikoerper, LOC738738 antikoerper, arpc3 antikoerper, LOC100036831 antikoerper, LOC100341254 antikoerper

Hintergrund: ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization