ARPC3 Antikörper (Middle Region)
-
- Target Alle ARPC3 Antikörper anzeigen
- ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARPC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARPC3 antibody was raised against the middle region of ARPC3
- Aufreinigung
- Affinity purified
- Immunogen
- ARPC3 antibody was raised using the middle region of ARPC3 corresponding to a region with amino acids ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
- Top Product
- Discover our top product ARPC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARPC3 Blocking Peptide, catalog no. 33R-4181, is also available for use as a blocking control in assays to test for specificity of this ARPC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))
- Andere Bezeichnung
- ARPC3 (ARPC3 Produkte)
- Synonyme
- ARC21 antikoerper, p21-Arc antikoerper, 1110006A04Rik antikoerper, 21kDa antikoerper, AA408672 antikoerper, AI788639 antikoerper, p21-Ar antikoerper, p21Arc antikoerper, arc21 antikoerper, p21-arc antikoerper, zgc:86828 antikoerper, actin related protein 2/3 complex subunit 3 antikoerper, actin related protein 2/3 complex, subunit 3 antikoerper, actin related protein 2/3 complex subunit 3 L homeolog antikoerper, actin related protein 2/3 complex, subunit 3, 21kDa antikoerper, actin related protein 2/3 complex subunit 3 pseudogene antikoerper, actin-related protein 2/3 complex subunit 3 antikoerper, actin-related protein 2/3 complex subunit 3 pseudogene antikoerper, ARPC3 antikoerper, Arpc3 antikoerper, arpc3.L antikoerper, LOC738738 antikoerper, arpc3 antikoerper, LOC100036831 antikoerper, LOC100341254 antikoerper
- Hintergrund
- ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Regulation of Actin Filament Polymerization
-