ARPC2 Antikörper (N-Term)

Produktnummer ABIN631598

Produktdetails anti-ARPC2 Antikörper

Target: ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARPC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARPC2 antibody was raised against the N terminal of ARPC2

Aufreinigung: Affinity purified

Immunogen: ARPC2 antibody was raised using the N terminal of ARPC2 corresponding to a region with amino acids MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARPC2 Blocking Peptide, catalog no. 33R-6593, is also available for use as a blocking control in assays to test for specificity of this ARPC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARPC2

Target: ARPC2 (Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2))

Andere Bezeichnung: ARPC2 (ARPC2 Produkte)

Synonyme: arc34 antikoerper, p34-arc antikoerper, pnas-139 antikoerper, pro2446 antikoerper, Arpc2 antikoerper, Arc-p34 antikoerper, 2210023N03Rik antikoerper, 34kDa antikoerper, p34-Arc antikoerper, fk84a07 antikoerper, wu:fa22f07 antikoerper, wu:fk84a07 antikoerper, zgc:77769 antikoerper, ARC34 antikoerper, PNAS-139 antikoerper, actin related protein 2/3 complex subunit 2 antikoerper, actin related protein 2/3 complex, subunit 2, 34kDa antikoerper, actin related protein 2/3 complex, subunit 2 antikoerper, actin related protein 2/3 complex subunit 2 S homeolog antikoerper, ARPC2 antikoerper, arpc2 antikoerper, Arpc2 antikoerper, arpc2.S antikoerper

Hintergrund: ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization