SHMT1 Antikörper

Produktnummer ABIN631508

Produktdetails anti-SHMT1 Antikörper

Target: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHMT1 Blocking Peptide, catalog no. 33R-6720, is also available for use as a blocking control in assays to test for specificity of this SHMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHMT1

Target: SHMT1 (serine Hydroxymethyltransferase 1 (Soluble) (SHMT1))

Andere Bezeichnung: SHMT1 (SHMT1 Produkte)

Synonyme: Shmt antikoerper, mShmt antikoerper, LRRGT00032 antikoerper, shmt1 antikoerper, MGC53442 antikoerper, zgc:66171 antikoerper, zgc:77524 antikoerper, SHMT1 antikoerper, Shmt1 antikoerper, CSHMT antikoerper, SHMT antikoerper, AI324848 antikoerper, AI385541 antikoerper, C81125 antikoerper, mshmt antikoerper, mshmt1 antikoerper, mshmt2 antikoerper, MEL-32 antikoerper, SHMT2 antikoerper, F20D10.50 antikoerper, F20D10_50 antikoerper, SERINE HYDROXYMETHYLTRANSFERASE 1 antikoerper, SERINE TRANSHYDROXYMETHYLASE antikoerper, SERINE TRANSHYDROXYMETHYLTRANSFERASE antikoerper, STM antikoerper, serine transhydroxymethyltransferase 1 antikoerper, serine hydroxymethyltransferase 1 antikoerper, serine hydroxymethyltransferase 1 (soluble) L homeolog antikoerper, serine hydroxymethyltransferase 1 (soluble) antikoerper, microRNA 6778 antikoerper, serine transhydroxymethyltransferase 1 antikoerper, Shmt1 antikoerper, shmt1.L antikoerper, shmt1 antikoerper, MIR6778 antikoerper, SHMT1 antikoerper, SHM1 antikoerper

Hintergrund: This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Molekulargewicht: 53 kDa (MW of target protein)