TTC8 Antikörper (N-Term)

Produktnummer ABIN631427

Produktdetails anti-TTC8 Antikörper

Target: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC8 antibody was raised against the N terminal of TTC8

Aufreinigung: Affinity purified

Immunogen: TTC8 antibody was raised using the N terminal of TTC8 corresponding to a region with amino acids ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC8 Blocking Peptide, catalog no. 33R-2599, is also available for use as a blocking control in assays to test for specificity of this TTC8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC8

Target: TTC8 (Tetratricopeptide Repeat Domain 8 (TTC8))

Andere Bezeichnung: TTC8 (TTC8 Produkte)

Synonyme: TTC8 antikoerper, bbs8 antikoerper, fk26c02 antikoerper, wu:fk26c02 antikoerper, zgc:136718 antikoerper, DKFZp459L2429 antikoerper, BBS8 antikoerper, RP51 antikoerper, 0610012F22Rik antikoerper, AV001447 antikoerper, tetratricopeptide repeat domain 8 antikoerper, TTC8 antikoerper, ttc8 antikoerper, lpa_01174 antikoerper, Ttc8 antikoerper

Hintergrund: The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Hedgehog Signalweg