PKC zeta Antikörper (N-Term)

Produktnummer ABIN631227

Produktdetails anti-PKC zeta Antikörper

Target: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PKC zeta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKCZ antibody was raised against the N terminal of PRKCZ

Aufreinigung: Affinity purified

Immunogen: PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PKC zeta

Target: PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))

Andere Bezeichnung: PRKCZ (PRKCZ Produkte)

Synonyme: TPKC antikoerper, PKCzeta antikoerper, prkcz-A antikoerper, pkc-zeta antikoerper, PRKCZ antikoerper, pkc2 antikoerper, PKC-ZETA antikoerper, PKC2 antikoerper, AI098070 antikoerper, C80388 antikoerper, Pkcz antikoerper, R74924 antikoerper, aPKCzeta antikoerper, zetaPKC antikoerper, 14-3-3-zetaisoform antikoerper, r14-3-3 antikoerper, pkcz antikoerper, si:ch211-150o23.4 antikoerper, protein kinase C zeta L homeolog antikoerper, protein kinase C zeta antikoerper, protein kinase C, zeta antikoerper, prkcz.L antikoerper, PRKCZ antikoerper, prkcz antikoerper, Prkcz antikoerper

Hintergrund: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, RTK Signalweg, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling