PRAME Antikörper (N-Term)

Produktnummer ABIN631204

Produktdetails anti-PRAME Antikörper

Target: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRAME Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRAME antibody was raised against the N terminal of PRAME

Aufreinigung: Affinity purified

Immunogen: PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRAME Blocking Peptide, catalog no. 33R-1390, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAME antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRAME

Target: PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))

Andere Bezeichnung: PRAME (PRAME Produkte)

Synonyme: PRAME antikoerper, CT130 antikoerper, MAPE antikoerper, OIP-4 antikoerper, OIP4 antikoerper, 4930534P07Rik antikoerper, preferentially expressed antigen in melanoma antikoerper, PRAME antikoerper, Prame antikoerper

Hintergrund: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Nuclear Hormone Receptor Binding