PRAME Antikörper (N-Term)
-
- Target Alle PRAME Antikörper anzeigen
- PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRAME Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRAME antibody was raised against the N terminal of PRAME
- Aufreinigung
- Affinity purified
- Immunogen
- PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
- Top Product
- Discover our top product PRAME Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRAME Blocking Peptide, catalog no. 33R-1390, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRAME antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAME (Preferentially Expressed Antigen in Melanoma (PRAME))
- Andere Bezeichnung
- PRAME (PRAME Produkte)
- Synonyme
- PRAME antikoerper, CT130 antikoerper, MAPE antikoerper, OIP-4 antikoerper, OIP4 antikoerper, 4930534P07Rik antikoerper, preferentially expressed antigen in melanoma antikoerper, PRAME antikoerper, Prame antikoerper
- Hintergrund
- PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Nuclear Hormone Receptor Binding
-