DYNLL1 Antikörper (Middle Region)

Produktnummer ABIN631190

Produktdetails anti-DYNLL1 Antikörper

Target: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYNLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DYNLL1 antibody was raised against the middle region of DYNLL1

Aufreinigung: Affinity purified

Immunogen: DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYNLL1 Blocking Peptide, catalog no. 33R-2498, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYNLL1

Target: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Andere Bezeichnung: DYNLL1 (DYNLL1 Produkte)

Synonyme: DLC1 antikoerper, DLC8 antikoerper, DNCL1 antikoerper, DNCLC1 antikoerper, LC8 antikoerper, LC8a antikoerper, PIN antikoerper, hdlc1 antikoerper, dynll2 antikoerper, wu:fd56c09 antikoerper, zgc:73406 antikoerper, Dlc8 antikoerper, Dnclc1 antikoerper, Pin antikoerper, 8kDLC antikoerper, lc8 antikoerper, dlc1 antikoerper, dlc8 antikoerper, lc8a antikoerper, dncl1 antikoerper, dnclc1 antikoerper, dynll1a antikoerper, MGC68763 antikoerper, CDLC2 antikoerper, dynll1 antikoerper, dynll1b antikoerper, pin antikoerper, MGC89636 antikoerper, dynein light chain LC8-type 1 antikoerper, dynein, light chain, LC8-type 1 antikoerper, dynein light chain LC8-type 1 S homeolog antikoerper, dynein light chain LC8-type 1 L homeolog antikoerper, Dynein light chain 1, cytoplasmic antikoerper, DYNLL1 antikoerper, dynll1 antikoerper, Dynll1 antikoerper, dynll1.S antikoerper, dynll1.L antikoerper, dlc-1 antikoerper

Hintergrund: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains.

Molekulargewicht: 10 kDa (MW of target protein)

Pathways: M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity