IDH1 Antikörper
-
- Target Alle IDH1 Antikörper anzeigen
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IDH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
- Top Product
- Discover our top product IDH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IDH1 Blocking Peptide, catalog no. 33R-9808, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
- Andere Bezeichnung
- IDH1 (IDH1 Produkte)
- Synonyme
- IDCD antikoerper, IDH antikoerper, IDP antikoerper, IDPC antikoerper, PICD antikoerper, NADP-CICDH antikoerper, AI314845 antikoerper, AI788952 antikoerper, E030024J03Rik antikoerper, Id-1 antikoerper, Idh-1 antikoerper, Idpc antikoerper, cb876 antikoerper, fm90e09 antikoerper, im:7143416 antikoerper, wu:fm90e09 antikoerper, F23E12.180 antikoerper, F23E12_180 antikoerper, IDH-I antikoerper, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antikoerper, isocitrate dehydrogenase 1 antikoerper, isocitrate dehydrogenase I antikoerper, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antikoerper, isocitrate dehydrogenase 1 (NADP+), soluble antikoerper, isocitrate dehydrogenase 1 (NADP+) L homeolog antikoerper, isocitrate dehydrogenase 1 antikoerper, IDH1 antikoerper, Idh1 antikoerper, idh1.L antikoerper, idh1 antikoerper
- Hintergrund
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-