STING/TMEM173 Antikörper (Middle Region)

Produktnummer ABIN630932

Produktdetails anti-STING/TMEM173 Antikörper

Target: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STING/TMEM173 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM173 antibody was raised against the middle region of TMEM173

Aufreinigung: Affinity purified

Immunogen: TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM173 Blocking Peptide, catalog no. 33R-2109, is also available for use as a blocking control in assays to test for specificity of this TMEM173 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM173 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STING/TMEM173

Target: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Andere Bezeichnung: TMEM173 (TMEM173 Produkte)

Synonyme: ERIS antikoerper, MITA antikoerper, MPYS antikoerper, NET23 antikoerper, STING antikoerper, 2610307O08Rik antikoerper, Mita antikoerper, RGD1562552 antikoerper, transmembrane protein 173 antikoerper, TMEM173 antikoerper, Tmem173 antikoerper

Hintergrund: TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Activation of Innate immune Response