DCLRE1C Antikörper
-
- Target Alle DCLRE1C Antikörper anzeigen
- DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCLRE1C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DCLRE1 C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
- Top Product
- Discover our top product DCLRE1C Primärantikörper
-
anti-DNA Cross-Link Repair 1C (DCLRE1C) (C-Term) antibody
DCLRE1C Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 21-50), (N-Term) antibodyDCLRE1C Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB24410 unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 482-495) antibodyDCLRE1C Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 21-50) antibodyDCLRE1C Reaktivität: Human, Maus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 301-400) antibodyDCLRE1C Reaktivität: Ratte WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 1-434) antibodyDCLRE1C Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 396-445) antibodyDCLRE1C Reaktivität: Human, Ratte, Meerschweinchen, Pferd, Hund, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (N-Term) antibodyDCLRE1C Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Rind (Kuh), Kaninchen, Zebrafisch (Danio rerio), Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 482-531), (pSer516) antibodyDCLRE1C Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DNA Cross-Link Repair 1C (DCLRE1C) (AA 482-531) antibodyDCLRE1C Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DCLRE1C Blocking Peptide, catalog no. 33R-8799, is also available for use as a blocking control in assays to test for specificity of this DCLRE1C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCLRE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCLRE1C (DNA Cross-Link Repair 1C (DCLRE1C))
- Andere Bezeichnung
- DCLRE1C (DCLRE1C Produkte)
- Synonyme
- artemis antikoerper, A-SCID antikoerper, DCLREC1C antikoerper, RS-SCID antikoerper, SCIDA antikoerper, SNM1C antikoerper, hSNM1C antikoerper, Snm1l antikoerper, nuclease antikoerper, 9930121L06Rik antikoerper, AI661365 antikoerper, Art antikoerper, DNA cross-link repair 1C antikoerper, DCLRE1C antikoerper, Dclre1c antikoerper
- Hintergrund
- DCLRE1C is a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity, it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins when complexed with protein kinase, DNA-activated, catalytic polypeptide. Mutations in this gene cause Athabascan-type severe combined immunodeficiency (SCIDA).
- Molekulargewicht
- 78 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-
