RCHY1 Antikörper (N-Term)

Produktnummer ABIN630818

Produktdetails anti-RCHY1 Antikörper

Target: RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RCHY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RCHY1 antibody was raised against the N terminal of RCHY1

Aufreinigung: Affinity purified

Immunogen: RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RCHY1 Blocking Peptide, catalog no. 33R-4551, is also available for use as a blocking control in assays to test for specificity of this RCHY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCHY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RCHY1

Target: RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))

Andere Bezeichnung: RCHY1 (RCHY1 Produkte)

Synonyme: ARNIP antikoerper, CHIMP antikoerper, PIRH2 antikoerper, PRO1996 antikoerper, RNF199 antikoerper, ZNF363 antikoerper, Pirh2 antikoerper, Zfp363 antikoerper, Znf363 antikoerper, wu:fb37e07 antikoerper, zgc:101128 antikoerper, RCHY1 antikoerper, arnip antikoerper, chimp antikoerper, pirh2 antikoerper, harnip antikoerper, rnf199 antikoerper, znf363 antikoerper, pro1996 antikoerper, ring finger and CHY zinc finger domain containing 1 antikoerper, ring finger and CHY zinc finger domain containing 1 L homeolog antikoerper, RCHY1 antikoerper, Rchy1 antikoerper, rchy1 antikoerper, rchy1.L antikoerper

Hintergrund: RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.

Molekulargewicht: 23 kDa (MW of target protein)