SPTAN1 Antikörper
-
- Target Alle SPTAN1 Antikörper anzeigen
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPTAN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
- Top Product
- Discover our top product SPTAN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTAN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
- Andere Bezeichnung
- SPTAN1 (SPTAN1 Produkte)
- Synonyme
- im:7157190 antikoerper, wu:fa20e05 antikoerper, wu:fb33g08 antikoerper, wu:fk32a10 antikoerper, zgc:112229 antikoerper, 2610027H02Rik antikoerper, Spna-2 antikoerper, Spna2 antikoerper, EIEE5 antikoerper, NEAS antikoerper, SPTA2 antikoerper, A2a antikoerper, IPF antikoerper, SPECA antikoerper, spectrin alpha, non-erythrocytic 1 antikoerper, spectrin, alpha, non-erythrocytic 1 antikoerper, SPTAN1 antikoerper, sptan1 antikoerper, Sptan1 antikoerper
- Hintergrund
- Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
- Molekulargewicht
- 272 kDa (MW of target protein)
- Pathways
- Caspase Kaskade in der Apoptose, Regulation of Actin Filament Polymerization
-