ERCC4 Antikörper (Middle Region)
-
- Target Alle ERCC4 Antikörper anzeigen
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERCC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ERCC4 antibody was raised against the middle region of Ercc4
- Aufreinigung
- Affinity purified
- Immunogen
- ERCC4 antibody was raised using the middle region of Ercc4 corresponding to a region with amino acids FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST
- Top Product
- Discover our top product ERCC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERCC4 Blocking Peptide, catalog no. 33R-2974, is also available for use as a blocking control in assays to test for specificity of this ERCC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERCC4 (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 4 (ERCC4))
- Andere Bezeichnung
- ERCC4 (ERCC4 Produkte)
- Synonyme
- ERCC11 antikoerper, FANCQ antikoerper, RAD1 antikoerper, XPF antikoerper, AI606920 antikoerper, Xpf antikoerper, RGD1560340 antikoerper, fi03a05 antikoerper, zgc:63468 antikoerper, wu:fi03a05 antikoerper, ercc11 antikoerper, rad1 antikoerper, xpf antikoerper, ERCC4 antikoerper, LOC100231158 antikoerper, ERCC excision repair 4, endonuclease catalytic subunit antikoerper, excision repair cross-complementing rodent repair deficiency, complementation group 4 antikoerper, excision repair cross-complementation group 4 antikoerper, excision repair cross-complementation group 4 L homeolog antikoerper, ERCC4 antikoerper, Ercc4 antikoerper, ercc4 antikoerper, ercc4.L antikoerper, XPF antikoerper
- Hintergrund
- The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1.
- Molekulargewicht
- 101 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-