GMP Synthase Antikörper (Middle Region)

Produktnummer ABIN630661

Produktdetails anti-GMP Synthase Antikörper

Target: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMP Synthase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GMPS antibody was raised against the middle region of GMPS

Aufreinigung: Affinity purified

Immunogen: GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMPS Blocking Peptide, catalog no. 33R-9455, is also available for use as a blocking control in assays to test for specificity of this GMPS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMP Synthase

Target: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Andere Bezeichnung: GMPS (GMPS Produkte)

Synonyme: GMPS antikoerper, AA591640 antikoerper, AI047208 antikoerper, sb:cb632 antikoerper, wu:fb76b01 antikoerper, wu:fi05a09 antikoerper, zgc:66002 antikoerper, guanine monophosphate synthase antikoerper, guanine monophosphate synthase L homeolog antikoerper, guanine monophosphate synthetase antikoerper, GMPS antikoerper, gmps.L antikoerper, gmps antikoerper, Gmps antikoerper

Hintergrund: In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

Molekulargewicht: 77 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process