DYRK1A Antikörper

Produktnummer ABIN630535

Produktdetails anti-DYRK1A Antikörper

Target: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYRK1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DYRK1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYRK1A Blocking Peptide, catalog no. 33R-4071, is also available for use as a blocking control in assays to test for specificity of this DYRK1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYRK0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYRK1A

Target: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Andere Bezeichnung: DYRK1A (DYRK1A Produkte)

Synonyme: DYRK1A antikoerper, dyrk antikoerper, dyrk1 antikoerper, hp86 antikoerper, mnb antikoerper, mnbh antikoerper, DYRK antikoerper, DYRK1 antikoerper, HP86 antikoerper, MNB antikoerper, MNBH antikoerper, MRD7 antikoerper, 2310043O08Rik antikoerper, D16Ertd272e antikoerper, D16Ertd493e antikoerper, Dyrk antikoerper, ENSMUSG00000074897 antikoerper, Gm10783 antikoerper, Mnbh antikoerper, Mp86 antikoerper, mmb antikoerper, PSK47 antikoerper, dual specificity tyrosine phosphorylation regulated kinase 1A antikoerper, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A antikoerper, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a antikoerper, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A S homeolog antikoerper, DYRK1A antikoerper, dyrk1a antikoerper, Dyrk1a antikoerper, dyrk1a.S antikoerper

Hintergrund: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development.

Molekulargewicht: 85 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases