NR2F6 Antikörper (N-Term)

Produktnummer ABIN630502

Produktdetails anti-NR2F6 Antikörper

Target: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR2F6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR2 F6 antibody was raised against the N terminal of NR2 6

Aufreinigung: Affinity purified

Immunogen: NR2 F6 antibody was raised using the N terminal of NR2 6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR2F6 Blocking Peptide, catalog no. 33R-1199, is also available for use as a blocking control in assays to test for specificity of this NR2F6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR2F6

Target: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Andere Bezeichnung: NR2F6 (NR2F6 Produkte)

Synonyme: EAR-2 antikoerper, EAR2 antikoerper, ERBAL2 antikoerper, AV090102 antikoerper, COUP-TF3 antikoerper, Erbal2 antikoerper, COUP(II) antikoerper, NR2F6 antikoerper, couptf2 antikoerper, fc94g11 antikoerper, wu:fc94g11 antikoerper, zgc:77259 antikoerper, ear-2 antikoerper, ear2 antikoerper, erbal2 antikoerper, nr2f6l antikoerper, wu:fc72d04 antikoerper, zgc:77260 antikoerper, nuclear receptor subfamily 2 group F member 6 antikoerper, nuclear receptor subfamily 2, group F, member 6 antikoerper, nuclear receptor subfamily 2, group F, member 6a antikoerper, nuclear receptor subfamily 2 group F member 6 L homeolog antikoerper, nuclear receptor subfamily 2, group F, member 6b antikoerper, NR2F6 antikoerper, Nr2f6 antikoerper, nr2f6a antikoerper, nr2f6.L antikoerper, nr2f6 antikoerper, nr2f6b antikoerper

Hintergrund: Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Photoperiodism