MCM5 Antikörper (N-Term)

Produktnummer ABIN630192

Produktdetails anti-MCM5 Antikörper

Target: MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MCM5 antibody was raised against the N terminal of MCM5

Aufreinigung: Purified

Immunogen: MCM5 antibody was raised using the N terminal of MCM5 corresponding to a region with amino acids MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM5 Blocking Peptide, catalog no. 33R-6425, is also available for use as a blocking control in assays to test for specificity of this MCM5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM5

Target: MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))

Andere Bezeichnung: MCM5 (MCM5 Produkte)

Synonyme: 23.m06024 antikoerper, cdc46 antikoerper, xmcm5 antikoerper, CDC46 antikoerper, P1-CDC46 antikoerper, Afu5g02520 antikoerper, NCU01171.1 antikoerper, AA617332 antikoerper, AI324988 antikoerper, AL033333 antikoerper, Cdc46 antikoerper, Mcmd5 antikoerper, mCD46 antikoerper, mCDC46 antikoerper, mcm5 antikoerper, wu:fb34a06 antikoerper, CG4082 antikoerper, DmCDC46 antikoerper, DmCDC465 antikoerper, DmMCM5 antikoerper, DmMcm5 antikoerper, DmeMCM5 antikoerper, Dmel\\CG4082 antikoerper, MCM5 antikoerper, McM5 antikoerper, PCR4 antikoerper, DNA replication licensing factor MCM5 antikoerper, minichromosome maintenance complex component 5 S homeolog antikoerper, minichromosome maintenance complex component 5 antikoerper, DNA replication licensing factor Mcm5 antikoerper, DNA replication licensing factor mcm5 antikoerper, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae) antikoerper, minichromosome maintenance complex component 5 L homeolog antikoerper, Minichromosome maintenance 5 antikoerper, DNA replication licensing factor mcm-5 antikoerper, BBOV_IV010040 antikoerper, mcm5.S antikoerper, MCM5 antikoerper, AFUA_5G02520 antikoerper, NCU01171 antikoerper, PVX_084615 antikoerper, LOC5576119 antikoerper, CpipJ_CPIJ008678 antikoerper, Bm1_24480 antikoerper, CMU_022890 antikoerper, Mcm5 antikoerper, mcm5 antikoerper, TP01_0722 antikoerper, mcm5.L antikoerper, mcm-5 antikoerper

Hintergrund: The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA