EIF4E2 Antikörper (N-Term)

Produktnummer ABIN629989

Produktdetails anti-EIF4E2 Antikörper

Target: EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2 (EIF4E2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4E2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: EIF4 E2 antibody was raised against the N terminal of EIF4 2

Aufreinigung: Purified

Immunogen: EIF4 E2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4E2 Blocking Peptide, catalog no. 33R-4279, is also available for use as a blocking control in assays to test for specificity of this EIF4E2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4E2

Target: EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2 (EIF4E2))

Andere Bezeichnung: EIF4E2 (EIF4E2 Produkte)

Synonyme: 4E-LP antikoerper, 4EHP antikoerper, EIF4EL3 antikoerper, IF4e antikoerper, Eif4el3 antikoerper, EIF4E2 antikoerper, id:ibd1007 antikoerper, zgc:110542 antikoerper, zgc:158544 antikoerper, MGC115622 antikoerper, 2700069E09Rik antikoerper, AI036339 antikoerper, AV129531 antikoerper, D0H0S6743E antikoerper, eukaryotic translation initiation factor 4E family member 2 antikoerper, eukaryotic translation initiation factor 4E member 2 antikoerper, eukaryotic translation initiation factor 4E family member 2 L homeolog antikoerper, EIF4E2 antikoerper, Eif4e2 antikoerper, eif4e2 antikoerper, eif4e2.L antikoerper

Hintergrund: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognises and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom