Peroxiredoxin 6 Antikörper (Middle Region)

Produktnummer ABIN629774

Produktdetails anti-Peroxiredoxin 6 Antikörper

Target: Peroxiredoxin 6 (PRDX6)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRDX6 antibody was raised against the middle region of PRDX6

Aufreinigung: Purified

Immunogen: PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDX6 Blocking Peptide, catalog no. 33R-1499, is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peroxiredoxin 6

Target: Peroxiredoxin 6 (PRDX6)

Andere Bezeichnung: PRDX6 (PRDX6 Produkte)

Synonyme: 1-Cys antikoerper, AOP2 antikoerper, NSGPx antikoerper, PRX antikoerper, aiPLA2 antikoerper, p29 antikoerper, 1-cysPrx antikoerper, 9430088D19Rik antikoerper, AA690119 antikoerper, Aop2 antikoerper, Aop2-rs3 antikoerper, Brp-12 antikoerper, CC26 antikoerper, CP-3 antikoerper, GPx antikoerper, Ltw-4 antikoerper, Ltw4 antikoerper, Lvtw-4 antikoerper, NSGP antikoerper, ORF06 antikoerper, Prdx5 antikoerper, Prdx6-rs3 antikoerper, mKIAA0106 antikoerper, zgc:73360 antikoerper, aop2 antikoerper, prx-6 antikoerper, prx6 antikoerper, prdx6 antikoerper, PHGPX antikoerper, peroxiredoxin 6 antikoerper, peroxiredoxin 6 S homeolog antikoerper, peroxiredoxin 6 L homeolog antikoerper, PRDX6 antikoerper, Prdx6 antikoerper, prdx6 antikoerper, prdx6.S antikoerper, prdx6.L antikoerper

Hintergrund: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Molekulargewicht: 25 kDa (MW of target protein)