GLS2 Antikörper
-
- Target Alle GLS2 Antikörper anzeigen
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
- Top Product
- Discover our top product GLS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLS2 Blocking Peptide, catalog no. 33R-3113, is also available for use as a blocking control in assays to test for specificity of this GLS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
- Andere Bezeichnung
- GLS2 (GLS2 Produkte)
- Synonyme
- si:ch211-216k22.10 antikoerper, GA antikoerper, GLS antikoerper, LGA antikoerper, hLGA antikoerper, A330074B06Rik antikoerper, AI195532 antikoerper, Lga antikoerper, Ga antikoerper, glutaminase 2 antikoerper, glutaminase 2a (liver, mitochondrial) antikoerper, glutaminase 2 (liver, mitochondrial) antikoerper, glsA2 antikoerper, LOAG_03311 antikoerper, gls2a antikoerper, GLS2 antikoerper, Gls2 antikoerper
- Hintergrund
- GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport, Warburg Effekt
-