NR1H2 Antikörper (Middle Region)

Produktnummer ABIN629580

Produktdetails anti-NR1H2 Antikörper

Target: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR1H2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR1 H2 antibody was raised against the middle region of NR1 2

Aufreinigung: Purified

Immunogen: NR1 H2 antibody was raised using the middle region of NR1 2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR1H2 Blocking Peptide, catalog no. 33R-6119, is also available for use as a blocking control in assays to test for specificity of this NR1H2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR1H2

Target: NR1H2 (Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2))

Andere Bezeichnung: NR1H2 (NR1H2 Produkte)

Synonyme: NR1H2 antikoerper, lxr-b antikoerper, lxrb antikoerper, ner antikoerper, ner-i antikoerper, rip15 antikoerper, unr antikoerper, DKFZp468A0622 antikoerper, AI194859 antikoerper, LXR antikoerper, LXRB antikoerper, LXRbeta antikoerper, NER1 antikoerper, OR-1 antikoerper, RIP15 antikoerper, UR antikoerper, Unr antikoerper, Unr2 antikoerper, LXR-b antikoerper, NER antikoerper, NER-I antikoerper, UNR antikoerper, nuclear receptor subfamily 1 group H member 2 antikoerper, nuclear receptor subfamily 1, group H, member 2 antikoerper, nuclear receptor subfamily 1 group H member 2 L homeolog antikoerper, NR1H2 antikoerper, nr1h2 antikoerper, Nr1h2 antikoerper, nr1h2.L antikoerper

Hintergrund: The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Nuclear Hormone Receptor Binding