Regucalcin Antikörper

Produktnummer ABIN5708276

Produktdetails anti-Regucalcin Antikörper

Target: Regucalcin (RGN)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Regucalcin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Regucalcin antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Regucalcin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Regucalcin

Target: Regucalcin (RGN)

Andere Bezeichnung: Regucalcin (RGN Produkte)

Synonyme: CG1803 antikoerper, Dmel\\CG1803 antikoerper, Regucalcin antikoerper, T1 antikoerper, GNL antikoerper, zgc:92078 antikoerper, smp30 antikoerper, xsmp-30 antikoerper, xsmp30 antikoerper, DyakGE16489 antikoerper, dyak_GLEANR_17905 antikoerper, GE16489 antikoerper, regucalcin antikoerper, SMP30 antikoerper, AI265316 antikoerper, RC antikoerper, rgn-A antikoerper, Rc antikoerper, Reguc antikoerper, SMP-30 antikoerper, CG1803 gene product from transcript CG1803-RA antikoerper, regucalcin antikoerper, GE16489 gene product from transcript GE16489-RB antikoerper, regucalcin (senescence marker protein-30) antikoerper, regucalcin L homeolog antikoerper, regucalcin antikoerper, rgn antikoerper, LOC465598 antikoerper, RGN antikoerper, Dyak\regucalcin antikoerper, Rgn antikoerper, rgn.L antikoerper

Hintergrund: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.

UniProt: Q15493