ATF4 Antikörper

Produktnummer ABIN5693161

Produktdetails anti-ATF4 Antikörper

Target: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marke: Picoband™

Sequenz: KELEKKNEAL KERADSLAKE IQYLKDLIEE VRKARGKKRV P

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for ATF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-ATF4 Antikörper (ABIN5693161)

Hu, Li, Li: "MARVELD1 Inhibits Nonsense-Mediated RNA Decay by Repressing Serine Phosphorylation of UPF1." in: PLoS ONE, Vol. 8, Issue 6, pp. e68291, (2013) (PubMed).

Details zu ATF4

Target: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Andere Bezeichnung: ATF4 (ATF4 Produkte)

Synonyme: CREB-2 antikoerper, CREB2 antikoerper, TAXREB67 antikoerper, TXREB antikoerper, ATF4 antikoerper, atf-4 antikoerper, creb-2 antikoerper, creb2 antikoerper, taxreb67 antikoerper, txreb antikoerper, atf4 antikoerper, wu:fj01c08 antikoerper, wu:fk30b04 antikoerper, zgc:85951 antikoerper, sb:eu681 antikoerper, wu:fb08f07 antikoerper, zgc:171702 antikoerper, Atf-4 antikoerper, C/ATF antikoerper, ATF4-I antikoerper, atf4-a antikoerper, atf4-b antikoerper, atf4-ii antikoerper, activating transcription factor 4 antikoerper, activating transcription factor 4 L homeolog antikoerper, activating transcription factor 4a antikoerper, activating transcription factor 4b antikoerper, activating transcription factor 4 S homeolog antikoerper, ATF4 antikoerper, atf4 antikoerper, Atf4 antikoerper, atf4.L antikoerper, atf4a antikoerper, atf4b antikoerper, atf4.S antikoerper

Hintergrund:

Synonyms: Cyclic AMP-dependent transcription factor ATF-4, cAMP-dependent transcription factor ATF-4, Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, DNA-binding protein TAXREB67, Tax-responsive enhancer element-binding protein 67, TaxREB67, ATF4, CREB2, TXREB

Background: ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

UniProt: P18848

Pathways: Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Unfolded Protein Response