GFI1 Antikörper

Produktnummer ABIN5693139

Produktdetails anti-GFI1 Antikörper

Target: GFI1 (Growth Factor Independent 1 (GFI1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GFI1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: NLITHSRKHT GFKPFGCDLC GKGFQRKVDL RRHRETQH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for GFI1 detection. Tested with IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu GFI1

Target: GFI1 (Growth Factor Independent 1 (GFI1))

Andere Bezeichnung: GFI1 (GFI1 Produkte)

Synonyme: AW495828 antikoerper, Gfi-1 antikoerper, Pal-1 antikoerper, Pal1 antikoerper, GFI1 antikoerper, GFI-1 antikoerper, GFI1A antikoerper, SCN2 antikoerper, ZNF163 antikoerper, growth factor independent 1 antikoerper, growth factor independent 1 transcriptional repressor antikoerper, Gfi1 antikoerper, GFI1 antikoerper

Hintergrund:

Synonyms: Zinc finger protein Gfi-1, Growth factor independent protein 1, Zinc finger protein 163, GFI1, ZNF163

Background: Zinc finger protein Gfi-1 is a protein that in humans is encoded by the GFI1 gene. This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

UniProt: Q99684