SOD3 Antikörper

Produktnummer ABIN5692939

Produktdetails anti-SOD3 Antikörper

Target: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOD3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: WTGEDSAEPN SDSAEWIRDM YAKVTEIWQE VMQRRDDD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SOD3 detection. Tested with IHC-P in Human

Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-SOD3 Antikörper (ABIN5692939)

Li, Xiao, Li, Li, Zeng, Liu, Liang, Li, Chu, Yang: "Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 1715-1722, (2018) (PubMed).

Details zu SOD3

Target: SOD3 (Superoxide Dismutase 3, Extracellular (SOD3))

Andere Bezeichnung: SOD3 (SOD3 Produkte)

Synonyme: EC-SOD antikoerper, ECSOD antikoerper, SOD3 antikoerper, AI314465 antikoerper, LOC780439 antikoerper, fb05f10 antikoerper, si:dkey-117m1.6 antikoerper, sod3 antikoerper, wu:fb05f10 antikoerper, ECSODPT antikoerper, CuZnSOD antikoerper, SODA.4 antikoerper, superoxide dismutase 3 antikoerper, superoxide dismutase 3, extracellular antikoerper, superoxide dismutase 3, extracellular b antikoerper, superoxide dismutase 1 antikoerper, superoxide dismutase precursor ,putative antikoerper, SOD3 antikoerper, Sod3 antikoerper, sod3b antikoerper, sod3 antikoerper, Sod1 antikoerper, Smp_095980 antikoerper

Hintergrund:

Synonyms: Extracellular superoxide dismutase [Cu-Zn], EC-SOD, 1.15.1.1, SOD3

Tissue Specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.

Background: SOD3 (SUPEROXIDE DISMUTASE 3), also called SUPEROXIDE DISMUTASE, EXTRACELLULAR, EC-SOD, and Cu-Zn, is an enzyme that in humans is encoded by the SOD3 gene. This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. Hendrickson et al. (1990) mapped the SOD3 gene to 4pter-q21 by a study of somatic cell hybrids. Stern et al. (2003) narrowed the assignment to 4p15.3-p15.1 by somatic cell and radiation hybrid analysis, linkage mapping, and FISH. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM.

UniProt: P08294