Regucalcin Antikörper

Produktnummer ABIN5692930

Produktdetails anti-Regucalcin Antikörper

Target: Regucalcin (RGN)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Regucalcin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: YSVDAFDYDL QTGQISNRRS VYKLEKEEQI PD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Regucalcin detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu Regucalcin

Target: Regucalcin (RGN)

Andere Bezeichnung: RGN (RGN Produkte)

Synonyme: CG1803 antikoerper, Dmel\\CG1803 antikoerper, Regucalcin antikoerper, T1 antikoerper, GNL antikoerper, zgc:92078 antikoerper, smp30 antikoerper, xsmp-30 antikoerper, xsmp30 antikoerper, DyakGE16489 antikoerper, dyak_GLEANR_17905 antikoerper, GE16489 antikoerper, regucalcin antikoerper, SMP30 antikoerper, AI265316 antikoerper, RC antikoerper, rgn-A antikoerper, Rc antikoerper, Reguc antikoerper, SMP-30 antikoerper, CG1803 gene product from transcript CG1803-RA antikoerper, regucalcin antikoerper, GE16489 gene product from transcript GE16489-RB antikoerper, regucalcin (senescence marker protein-30) antikoerper, regucalcin L homeolog antikoerper, regucalcin antikoerper, rgn antikoerper, LOC465598 antikoerper, RGN antikoerper, Dyak\regucalcin antikoerper, Rgn antikoerper, rgn.L antikoerper

Hintergrund:

Synonyms: Regucalcin, RC, Gluconolactonase, GNL, Senescence marker protein 30, SMP-30, RGN, SMP30

Background: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.

UniProt: Q15493