BMP5 Antikörper (C-Term) (DyLight 488)
-
- Target Alle BMP5 Antikörper anzeigen
- BMP5 (Bone Morphogenetic Protein 5 (BMP5))
-
Bindungsspezifität
- AA 332-365, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BMP5 Antikörper ist konjugiert mit DyLight 488
-
Applikation
- Flow Cytometry (FACS)
- Sequenz
- HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG Polyclonal Anti-Human BMP5 Antibody DyLight® 488 Conjugated, Flow Validated.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
- Top Product
- Discover our top product BMP5 Primärantikörper
-
-
- Applikationshinweise
-
Application Details: Flow Cytometry, 1-3 μg/1x106 cells
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C
- Informationen zur Lagerung
- At 2-8°C for one year. Protect from light. Do not freeze.
-
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
: "
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
-
- Target
- BMP5 (Bone Morphogenetic Protein 5 (BMP5))
- Andere Bezeichnung
- BMP5 (BMP5 Produkte)
- Synonyme
- bmp5l antikoerper, hm:zehl0669 antikoerper, zehl0669 antikoerper, zgc:64230 antikoerper, BMP5 antikoerper, AU023399 antikoerper, se antikoerper, bone morphogenetic protein 5 antikoerper, bmp5 antikoerper, BMP5 antikoerper, LOC100539495 antikoerper, Bmp5 antikoerper
- Hintergrund
-
Synonyms: Bone morphogenetic protein 5, BMP-5, BMP5
Tissue Specificity: Expressed in the lung and liver.
Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
- UniProt
- P22003
- Pathways
- Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process
-