BMP5 Antikörper (C-Term) (DyLight 488)

Produktnummer ABIN7354761

Produktdetails anti-BMP5 Antikörper (DyLight 488)

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Bindungsspezifität: AA 332-365, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMP5 Antikörper ist konjugiert mit DyLight 488

Applikation: Flow Cytometry (FACS)

Sequenz: HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG Polyclonal Anti-Human BMP5 Antibody DyLight® 488 Conjugated, Flow Validated.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Anwendungsinformationen

Applikationshinweise:

Application Details: Flow Cytometry, 1-3 μg/1x10⁶ cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Informationen zur Lagerung: At 2-8°C for one year. Protect from light. Do not freeze.

Referenzen für anti-BMP5 Antikörper (DyLight 488) (ABIN7354761)

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).

Details zu BMP5

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Andere Bezeichnung: BMP5 (BMP5 Produkte)

Synonyme: bmp5l antikoerper, hm:zehl0669 antikoerper, zehl0669 antikoerper, zgc:64230 antikoerper, BMP5 antikoerper, AU023399 antikoerper, se antikoerper, bone morphogenetic protein 5 antikoerper, bmp5 antikoerper, BMP5 antikoerper, LOC100539495 antikoerper, Bmp5 antikoerper

Hintergrund:

Synonyms: Bone morphogenetic protein 5, BMP-5, BMP5

Tissue Specificity: Expressed in the lung and liver.

Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process