BMP5 Antikörper

Produktnummer ABIN4950346

Produktdetails anti-BMP5 Antikörper

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Aufreinigung: Antigen affinity

Immunogen: Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the BMP5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the BMP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu BMP5

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Andere Bezeichnung: BMP5 (BMP5 Produkte)

Synonyme: bmp5l antikoerper, hm:zehl0669 antikoerper, zehl0669 antikoerper, zgc:64230 antikoerper, BMP5 antikoerper, AU023399 antikoerper, se antikoerper, bone morphogenetic protein 5 antikoerper, bmp5 antikoerper, BMP5 antikoerper, LOC100539495 antikoerper, Bmp5 antikoerper

Hintergrund: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process