KDM5B Antikörper (AA 641-685)

Produktnummer ABIN5647866

Produktdetails anti-KDM5B Antikörper

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Bindungsspezifität: AA 641-685

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDM5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KDM5B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KDM5B

Target: KDM5B (Lysine (K)-Specific Demethylase 5B (KDM5B))

Andere Bezeichnung: KDM5B / Jarid1B (KDM5B Produkte)

Synonyme: jarid1b antikoerper, jarid1ba antikoerper, id:ibd5050 antikoerper, wu:fd15c05 antikoerper, cb264 antikoerper, jarid1bb antikoerper, plu1 antikoerper, wu:fc44h11 antikoerper, zgc:85741 antikoerper, JARID1B antikoerper, CT31 antikoerper, PLU-1 antikoerper, PLU1 antikoerper, PUT1 antikoerper, RBBP2H1A antikoerper, 2010009J12Rik antikoerper, 2210016I17Rik antikoerper, AW556288 antikoerper, D1Ertd202e antikoerper, Jarid1b antikoerper, Plu1 antikoerper, Rb-Bp2 antikoerper, mKIAA4034 antikoerper, RGD1565602 antikoerper, lysine (K)-specific demethylase 5Ba antikoerper, lysine (K)-specific demethylase 5Bb antikoerper, lysine demethylase 5B antikoerper, lysine (K)-specific demethylase 5B antikoerper, kdm5ba antikoerper, kdm5bb antikoerper, KDM5B antikoerper, Kdm5b antikoerper

Hintergrund: Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.

UniProt: Q9UGL1

Pathways: Warburg Effekt