HMGB2 Antikörper

Produktnummer ABIN5647796

Produktdetails anti-HMGB2 Antikörper

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the HMGB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HMGB2

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Andere Bezeichnung: HMGB2 (HMGB2 Produkte)

Synonyme: HMG2 antikoerper, C80539 antikoerper, HMG-2 antikoerper, Hmg2 antikoerper, HIGH MOBILITY GROUP BETA 1 antikoerper, HMG BETA 1 antikoerper, NFD02 antikoerper, NFD2 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2 antikoerper, high mobility group B2 antikoerper, hmgb2 antikoerper, hmgb2l antikoerper, im:6909096 antikoerper, wu:fa20b02 antikoerper, zgc:101854 antikoerper, wu:fb22b10 antikoerper, wu:fc95d12 antikoerper, zgc:123215 antikoerper, high mobility group box 2 antikoerper, high mobility group box 2 S homeolog antikoerper, high mobility group B2 antikoerper, high mobility group box 2b antikoerper, high mobility group box 2a antikoerper, HMGB2 antikoerper, Hmgb2 antikoerper, hmgb2.S antikoerper, hmgb2b antikoerper, hmgb2a antikoerper

Hintergrund: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

UniProt: P26583

Pathways: Cellular Response to Molecule of Bacterial Origin