HMGB2 Antikörper (N-Term)

Produktnummer ABIN4886620

Produktdetails anti-HMGB2 Antikörper

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Bindungsspezifität: AA 65-97, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KSDKARYDRE MKNYVPPKGD KKGKKKDPNA PKR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 2
Protein Name: High mobility group protein B2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HMGB2

Target: HMGB2 (High Mobility Group Box 2 (HMGB2))

Andere Bezeichnung: HMGB2 (HMGB2 Produkte)

Synonyme: HMG2 antikoerper, C80539 antikoerper, HMG-2 antikoerper, Hmg2 antikoerper, HIGH MOBILITY GROUP BETA 1 antikoerper, HMG BETA 1 antikoerper, NFD02 antikoerper, NFD2 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2 antikoerper, high mobility group B2 antikoerper, hmgb2 antikoerper, hmgb2l antikoerper, im:6909096 antikoerper, wu:fa20b02 antikoerper, zgc:101854 antikoerper, wu:fb22b10 antikoerper, wu:fc95d12 antikoerper, zgc:123215 antikoerper, high mobility group box 2 antikoerper, high mobility group box 2 S homeolog antikoerper, high mobility group B2 antikoerper, high mobility group box 2b antikoerper, high mobility group box 2a antikoerper, HMGB2 antikoerper, Hmgb2 antikoerper, hmgb2.S antikoerper, hmgb2b antikoerper, hmgb2a antikoerper

Hintergrund: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Synonyms: C80539 | HMG2 | HMG-2 | HMG 2 | HMG B2 | HMGB2 | P26583

Gen-ID: 3148

UniProt: P26583

Pathways: Cellular Response to Molecule of Bacterial Origin