Adenylosuccinate Lyase Antikörper

Produktnummer ABIN5647427

Produktdetails anti-Adenylosuccinate Lyase Antikörper

Target: Adenylosuccinate Lyase (ADSL)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylosuccinate Lyase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN were used as the immunogen for the ASL antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ASL antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ASL antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Adenylosuccinate Lyase

Target: Adenylosuccinate Lyase (ADSL)

Andere Bezeichnung: ASL / Adenylosuccinate Lyase (ADSL Produkte)

Synonyme: fi60b04 antikoerper, zgc:56061 antikoerper, wu:fi60b04 antikoerper, MGC53383 antikoerper, MGC69239 antikoerper, adsL antikoerper, F15C21.8 antikoerper, F15C21_8 antikoerper, AMPS antikoerper, ASASE antikoerper, ASL antikoerper, Adl antikoerper, Asl antikoerper, purB antikoerper, adenylosuccinate lyase antikoerper, adenylosuccinate lyase L homeolog antikoerper, adenylosuccinase; ASL antikoerper, Adenylosuccinate lyase antikoerper, L-Aspartase-like family protein antikoerper, ADSL antikoerper, adsl antikoerper, adsl.L antikoerper, ASL antikoerper, purB antikoerper, purB,adsL antikoerper, Mrub_2293 antikoerper, MMAH_RS02975 antikoerper, Arnit_0089 antikoerper, Mesil_1058 antikoerper, Slip_0597 antikoerper, Trad_2452 antikoerper, Deba_0652 antikoerper, Toce_1174 antikoerper, Acear_2324 antikoerper, Igag_0272 antikoerper, Saut_2156 antikoerper, Fbal_1996 antikoerper, Ndas_2434 antikoerper, Ilyop_0196 antikoerper, Lbys_2961 antikoerper, MFER_RS02920 antikoerper, Palpr_2192 antikoerper, Calni_0061 antikoerper, Ftrac_3746 antikoerper, AT1G36280 antikoerper, Olsu_1764 antikoerper, Adsl antikoerper

Hintergrund: ASL (argininosuccinate lyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.

UniProt: P04424

Pathways: Ribonucleoside Biosynthetic Process