UCP2 Antikörper (Middle Region)
-
- Target Alle UCP2 Antikörper anzeigen
- UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))
-
Bindungsspezifität
- AA 134-170, Middle Region
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UCP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- AQPTDVVKVR FQAQARAGGG RRYQSTVNAY KTIAREE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Mitochondrial uncoupling protein 2(UCP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: uncoupling protein 2
Protein Name: Mitochondrial uncoupling protein 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product UCP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Exhaustive training increases uncoupling protein 2 expression and decreases Bcl-2/Bax ratio in rat skeletal muscle." in: Oxidative medicine and cellular longevity, Vol. 2013, pp. 780719, (2013) (PubMed).
: "
-
Exhaustive training increases uncoupling protein 2 expression and decreases Bcl-2/Bax ratio in rat skeletal muscle." in: Oxidative medicine and cellular longevity, Vol. 2013, pp. 780719, (2013) (PubMed).
-
- Target
- UCP2 (Uncoupling Protein 2 (Mitochondrial, Proton Carrier) (UCP2))
- Andere Bezeichnung
- UCP2 (UCP2 Produkte)
- Synonyme
- UCP2 antikoerper, DKFZp470P1633 antikoerper, ucp2 antikoerper, MGC53319 antikoerper, MGC75881 antikoerper, cb74 antikoerper, ATUCP2 antikoerper, K19M22.21 antikoerper, K19M22_21 antikoerper, uncoupling protein 2 antikoerper, BMIQ4 antikoerper, SLC25A8 antikoerper, UCPH antikoerper, Slc25a8 antikoerper, mitochondrial uncoupling protein 2 antikoerper, uncoupling protein 2 antikoerper, uncoupling protein 2 (mitochondrial, proton carrier) L homeolog antikoerper, uncoupling protein 2 (mitochondrial, proton carrier) antikoerper, uncoupling protein 1 antikoerper, PTRG_09289 antikoerper, UCP2 antikoerper, LOC100282746 antikoerper, ucp2.L antikoerper, ucp2 antikoerper, ucp1 antikoerper, Ucp2 antikoerper
- Hintergrund
-
Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.
Synonyms: Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8, UCPH, UCP2, SLC25A8 - Gen-ID
- 7351
- UniProt
- P55851
- Pathways
- Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Proton Transport
-