PTGS2 Antikörper (Middle Region)

Produktnummer ABIN5518867

Produktdetails anti-PTGS2 Antikörper

Target: PTGS2 (Prostaglandin-Endoperoxide Synthase 2 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS2))

Bindungsspezifität: AA 365-397, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Prostaglandin G/H synthase 2(PTGS2) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: AEFNTLYHWH PLLPDTFQIH DQKYNYQQFI YNN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Prostaglandin G/H synthase 2(PTGS2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Protein Name: Prostaglandin G/H synthase 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-PTGS2 Antikörper (ABIN5518867)

Li, Zhou, Wei, Chen, Geng, Zheng, Chai, Li, Jiang: "miR-144 and targets, c-fos and cyclooxygenase-2 (COX2), modulate synthesis of PGE2 in the amnion during pregnancy and labor." in: Scientific reports, Vol. 6, pp. 27914, (2018) (PubMed).

Wang, Yuan, Wang, Yang, Chen, Liu, Song, Feng, Tan, Jia: "Anti-inflammatory Effects of Phyllanthus emblica L on Benzopyrene-Induced Precancerous Lung Lesion by Regulating the IL-1β/miR-101/Lin28B Signaling Pathway." in: Integrative cancer therapies, Vol. 16, Issue 4, pp. 505-515, (2018) (PubMed).

Wang, Duan, Wu, Min, Huang, Luo, He: "Effect of cyclooxygenase‑2 inhibition on the development of post‑traumatic stress disorder in rats." in: Molecular medicine reports, Vol. 17, Issue 4, pp. 4925-4932, (2018) (PubMed).

Sun, Xue, Xue, Ren, Wu, Wang: "Acetylpuerarin protects against OGD-induced cell injury in BV2 microglia by inhibiting HMGB1 release." in: Die Pharmazie, Vol. 73, Issue 2, pp. 92-97, (2018) (PubMed).

Liu, Jia, Chong, Jiang, Yang, Li, Ma, Sun, Zhou: "Effects of oral cimetidine on the reproductive system of male rats." in: Experimental and therapeutic medicine, Vol. 15, Issue 6, pp. 4643-4650, (2018) (PubMed).

Ahmadieh, Nourinia, Hafezi-Moghadam, Sabbaghi, Nakao, Zandi, Yaseri, Tofighi, Akbarian: "Intravitreal injection of a Rho-kinase inhibitor (fasudil) combined with bevacizumab versus bevacizumab monotherapy for diabetic macular oedema: a pilot randomised clinical trial." in: The British journal of ophthalmology, (2018) (PubMed).

Alsaegh, Miyashita, Taniguchi, Zhu: "Odontogenic epithelial proliferation is correlated with COX-2 expression in dentigerous cyst and ameloblastoma." in: Experimental and therapeutic medicine, Vol. 13, Issue 1, pp. 247-253, (2017) (PubMed).

Sun, Yang, Zhang, Zhao: "Esculentoside A ameliorates cecal ligation and puncture-induced acute kidney injury in rats." in: Experimental animals, (2017) (PubMed).

Jiang, Tian, Tang, Ou, Xu et al.: "Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) Downregulates the Expression of Protumor Factors Cyclooxygenase-2 and Inducible Nitric Oxide Synthase in a GM-CSF Receptor-Independent Manner ..." in: Mediators of inflammation, Vol. 2015, pp. 601604, (2016) (PubMed).

Lin, Huang, Shen, Yiming: "MicroRNA-101 regulates the viability and invasion of cervical cancer cells." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10148-55, (2016) (PubMed).

Shen, Chen, Zhang, Du, Bai, Zhang, Jiang, Li, Wang, Zhu: "MicroRNA-27b Regulates Mitochondria Biogenesis in Myocytes." in: PLoS ONE, Vol. 11, Issue 2, pp. e0148532, (2016) (PubMed).

Zhao, Zhao, Wang, Li, Zhang: "Glycyrrhizic Acid Attenuates Sepsis-Induced Acute Kidney Injury by Inhibiting NF-κB Signaling Pathway." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2016, pp. 8219287, (2016) (PubMed).

Zhen, Zong, Gao, Cao, Jiang, Chen, Wang, Sun, Peng, Bai, Li: "Preparation and characterization of a novel aspirin derivative with anti-thrombotic and gastric mucosal protection properties." in: PLoS ONE, Vol. 9, Issue 6, pp. e98513, (2015) (PubMed).

Wang, Yang, Cui, Chen, Jiang: "Anti-inflammatory and anti-nociceptive activities of methanol extract from aerial part of Phlomis younghusbandii Mukerjee." in: PLoS ONE, Vol. 9, Issue 3, pp. e89149, (2014) (PubMed).

Cao, Zhang, Xie, Jiang, Ji, Gao: "Chemokine CXCL1 enhances inflammatory pain and increases NMDA receptor activity and COX-2 expression in spinal cord neurons via activation of CXCR2." in: Experimental neurology, Vol. 261, pp. 328-36, (2014) (PubMed).

Liu, Yan, Li, Yin, Sun, Kou, Ye, Ferns, Liu, Liu: "Reduced expression of SOX7 in ovarian cancer: a novel tumor suppressor through the Wnt/?-catenin signaling pathway." in: Journal of ovarian research, Vol. 7, pp. 87, (2014) (PubMed).

Yang, Wang, Wang, Xu, He, Wen, Yan, Su, Zhu: "Toll-like receptor 4 prompts human breast cancer cells invasiveness via lipopolysaccharide stimulation and is overexpressed in patients with lymph node metastasis." in: PLoS ONE, Vol. 9, Issue 10, pp. e109980, (2014) (PubMed).

Duan, Que, Lv, Li, Yin, Zhang: "Tolerance of neurite outgrowth to Rho kinase inhibitors decreased by cyclooxygenase-2 inhibitor." in: Neural regeneration research, Vol. 7, Issue 34, pp. 2705-12, (2014) (PubMed).

Wang, Du, Wang, Kuang, Wang: "Z-ligustilide attenuates lipopolysaccharide-induced proinflammatory response via inhibiting NF-kappaB pathway in primary rat microglia." in: Acta pharmacologica Sinica, Vol. 31, Issue 7, pp. 791-7, (2010) (PubMed).

Details zu PTGS2

Target: PTGS2 (Prostaglandin-Endoperoxide Synthase 2 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS2))

Andere Bezeichnung: PTGS2 (PTGS2 Produkte)

Synonyme: COX-2 antikoerper, COX2 antikoerper, GRIPGHS antikoerper, PGG/HS antikoerper, PGHS-2 antikoerper, PHS-2 antikoerper, hCox-2 antikoerper, Cox-2 antikoerper, Pghs2 antikoerper, TIS10 antikoerper, Cox2 antikoerper, cox-2 antikoerper, CEF147 antikoerper, PGHS2 antikoerper, PHSII antikoerper, cox2 antikoerper, gripghs antikoerper, pgg/hs antikoerper, pghs-2 antikoerper, phs-2 antikoerper, PTGS2 antikoerper, hcox-2 antikoerper, fj02a10 antikoerper, ptgs2 antikoerper, unp1239 antikoerper, wu:fj02a10 antikoerper, zCOX-2 antikoerper, si:dkey-97o5.6 antikoerper, prostaglandin-endoperoxide synthase 2 antikoerper, prostaglandin G/H synthase 2 antikoerper, prostaglandin-endoperoxide synthase 2S homeolog antikoerper, prostaglandin-endoperoxide synthase 2a antikoerper, prostaglandin-endoperoxide synthase 2b antikoerper, PTGS2 antikoerper, Ptgs2 antikoerper, LOC100136456 antikoerper, ptgs2.S antikoerper, ptgs2 antikoerper, ptgs2a antikoerper, ptgs2b antikoerper

Hintergrund: Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.

Synonyms: Prostaglandin G/H synthase 2 | 1.14.99.1 | Cyclooxygenase-2 | COX-2 | PHS II | Prostaglandin H2 synthase 2 | PGH synthase 2 | PGHS-2 | Prostaglandin-endoperoxide synthase 2 | PTGS2 | COX2 | P35354

Gen-ID: 5743

UniProt: P35354

Pathways: Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation