PDGFB Antikörper (C-Term)

Produktnummer ABIN5518861

Produktdetails anti-PDGFB Antikörper

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Bindungsspezifität: AA 89-129, C-Term

Reaktivität: Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDGFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Platelet-derived growth factor subunit B(PDGFB) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: AEPAMIAECK TRTEVFEISR RLIDRTNANF LVWPPCVEVQ R

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Platelet-derived growth factor subunit B(PDGFB) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: platelet derived growth factor subunit B
Protein Name: Platelet-derived growth factor subunit B

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-PDGFB Antikörper (ABIN5518861)

Hong, Hong, Chen, Wang, Hong: "Investigation of the protective effect of erythropoietin on spinal cord injury in rats." in: Experimental and therapeutic medicine, Vol. 2, Issue 5, pp. 837-841, (2012) (PubMed).

Wang, Leung, Xu: "Low-intensity ultrasound-induced cellular destruction and autophagy of nasopharyngeal carcinoma cells." in: Experimental and therapeutic medicine, Vol. 2, Issue 5, pp. 849-852, (2011) (PubMed).

Details zu PDGFB

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Andere Bezeichnung: PDGFB (PDGFB Produkte)

Synonyme: PDGF-2 antikoerper, PDGF2 antikoerper, SIS antikoerper, SSV antikoerper, c-sis antikoerper, pdgf2 antikoerper, sis antikoerper, si:ch211-79m20.1 antikoerper, si:dkey-261d11.1 antikoerper, PDGF-B antikoerper, Sis antikoerper, platelet derived growth factor subunit B antikoerper, platelet-derived growth factor beta polypeptide antikoerper, platelet derived growth factor subunit B S homeolog antikoerper, platelet-derived growth factor beta polypeptide a antikoerper, platelet derived growth factor, B polypeptide antikoerper, PDGFB antikoerper, pdgfb.S antikoerper, pdgfba antikoerper, Pdgfb antikoerper

Hintergrund: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Synonyms: Becaplermin | PDGF2 | PDGF-2 | PDGF 2 | PDGF B chain | PDGF subunit B | Pdgfb | SIS | SSV | P01127

Gen-ID: 5155

UniProt: P01127

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling