UBA3 Antikörper

Produktnummer ABIN4953000

Produktdetails anti-UBA3 Antikörper

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD of human UBE1C/UBA3 were used as the immunogen for the UBE1C antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the UBE1C antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the UBE1C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu UBA3

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Andere Bezeichnung: UBE1C / UBA3 (UBA3 Produkte)

Synonyme: UBE1C antikoerper, hUBA3 antikoerper, Ube1c antikoerper, ube1c antikoerper, wu:fb75e04 antikoerper, wu:fc37b11 antikoerper, zgc:55528 antikoerper, A830034N06Rik antikoerper, AI256736 antikoerper, AI848246 antikoerper, AW546539 antikoerper, ubiquitin like modifier activating enzyme 3 antikoerper, ubiquitin-like modifier activating enzyme 3 antikoerper, ubiquitin like modifier activating enzyme 3 S homeolog antikoerper, UBA3 antikoerper, Uba3 antikoerper, uba3 antikoerper, uba3.S antikoerper

Hintergrund: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

UniProt: Q8TBC4