PDPK1 Antikörper

Produktnummer ABIN4952109

Produktdetails anti-PDPK1 Antikörper

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDPK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Aufreinigung: Antigen affinity

Immunogen: Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PDPK1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PDPK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PDPK1

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Andere Bezeichnung: PDPK1 / 3-phosphoinositide-dependent protein kinase 1 (PDPK1 Produkte)

Synonyme: pdpk1 antikoerper, MGC82080 antikoerper, PDK1 antikoerper, PDPK2 antikoerper, PRO0461 antikoerper, Pdk1 antikoerper, zgc:153787 antikoerper, 3'-phosphoinositide-dependent protein kinase 1 antikoerper, 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 antikoerper, ATPDK1 antikoerper, AtPDK1 antikoerper, T32M21.110 antikoerper, T32M21_110 antikoerper, zgc:77318 antikoerper, 3-phosphoinositide dependent protein kinase 1 antikoerper, 3-phosphoinositide dependent protein kinase 1 L homeolog antikoerper, 3-phosphoinositide dependent protein kinase-1 antikoerper, 3-phosphoinositide dependent protein kinase 1a antikoerper, 3-phosphoinositide-dependent protein kinase 1 antikoerper, 3'-phosphoinositide-dependent protein kinase 1 antikoerper, 3-phosphoinositide dependent protein kinase 1b antikoerper, PDPK1 antikoerper, pdpk1.L antikoerper, pdpk1 antikoerper, Pdpk1 antikoerper, pdpk1a antikoerper, LOC100380750 antikoerper, pdk-1 antikoerper, PDK1 antikoerper, pdpk1b antikoerper

Hintergrund: 3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.

UniProt: O15530

Pathways: PI3K-Akt Signalweg, T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals