Kv1.4 Antikörper

Produktnummer ABIN4951575

Produktdetails anti-Kv1.4 Antikörper

Target: Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kv1.4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Kv1.4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Kv1.4

Target: Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))

Andere Bezeichnung: Kv1.4 (KCNA4 Produkte)

Synonyme: KV1.4 antikoerper, KCNA4 antikoerper, Kv1.4 antikoerper, DKFZp459N0126 antikoerper, KCHAN antikoerper, Kv4 antikoerper, RHK1 antikoerper, RK3 antikoerper, HBK4 antikoerper, HK1 antikoerper, HPCN2 antikoerper, HUKII antikoerper, KCNA4L antikoerper, KCNA8 antikoerper, PCN2 antikoerper, potassium voltage-gated channel subfamily A member 4 antikoerper, potassium voltage-gated channel subfamily A member 4 S homeolog antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 4 antikoerper, KCNA4 antikoerper, LOC100622932 antikoerper, kcna4.S antikoerper, Kcna4 antikoerper

Hintergrund: Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]

UniProt: P22459