IRF5 Antikörper

Produktnummer ABIN4951486

Produktdetails anti-IRF5 Antikörper

Target: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IRF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IRF5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IRF5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IRF5

Target: IRF5 (Interferon Regulatory Factor 5 (IRF5))

Andere Bezeichnung: IRF5 (IRF5 Produkte)

Synonyme: IRF5 antikoerper, irf5 antikoerper, SLEB10 antikoerper, AW491843 antikoerper, mirf5 antikoerper, im:7155364 antikoerper, zgc:76986 antikoerper, interferon regulatory factor 5 antikoerper, interferon regulatory factor 5 L homeolog antikoerper, IRF5 antikoerper, irf5 antikoerper, Irf5 antikoerper, irf5.L antikoerper

Hintergrund: Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity.

UniProt: Q13568

Pathways: TLR Signalweg, Autophagie