ING1 Antikörper

Produktnummer ABIN4951466

Produktdetails anti-ING1 Antikörper

Target: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ING1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ING1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ING1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ING1

Target: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Andere Bezeichnung: ING1 (ING1 Produkte)

Synonyme: p24ING1c antikoerper, p33 antikoerper, p33ING1 antikoerper, p33ING1b antikoerper, p47 antikoerper, p47ING1a antikoerper, p33ING1c antikoerper, zgc:136918 antikoerper, ING1 antikoerper, 2610028J21Rik antikoerper, AA407184 antikoerper, AI875420 antikoerper, mING1h antikoerper, p33Ing1 antikoerper, p37Ing1b antikoerper, xing1 antikoerper, inhibitor of growth family member 1 antikoerper, inhibitor of growth family, member 1 antikoerper, inhibitor of growth family member 1 S homeolog antikoerper, ING1 antikoerper, Ing1 antikoerper, ing1 antikoerper, ing1.S antikoerper

Hintergrund: Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

UniProt: Q9UK53

Pathways: Protein targeting to Nucleus, Autophagie