GNAQ Antikörper

Produktnummer ABIN4951194

Produktdetails anti-GNAQ Antikörper

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GNAQ antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GNAQ antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu GNAQ

Target: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Andere Bezeichnung: GNAQ (GNAQ Produkte)

Synonyme: si:ch73-270f14.2 antikoerper, CMC1 antikoerper, G-ALPHA-q antikoerper, GAQ antikoerper, SWS antikoerper, Galphaq antikoerper, Gnaq antikoerper, g-alpha-q antikoerper, gaq antikoerper, gnaqb antikoerper, 1110005L02Rik antikoerper, 6230401I02Rik antikoerper, AA408290 antikoerper, AW060788 antikoerper, Dsk1 antikoerper, Dsk10 antikoerper, Gq antikoerper, GqI antikoerper, guanine nucleotide binding protein (G protein), q polypeptide antikoerper, G protein subunit alpha q antikoerper, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antikoerper, guanine nucleotide binding protein, alpha q polypeptide antikoerper, gnaq antikoerper, GNAQ antikoerper, Gnaq antikoerper, gnaq.S antikoerper

Hintergrund: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

UniProt: P50148

Pathways: JAK-STAT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction