APH1A Antikörper

Produktnummer ABIN4950145

Produktdetails anti-APH1A Antikörper

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APH1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the APH1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the APH1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu APH1A

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Andere Bezeichnung: APH1A (APH1A Produkte)

Synonyme: 6530402N02Rik antikoerper, APH-1 antikoerper, APH-1A antikoerper, CGI-78 antikoerper, RGD1311546 antikoerper, APH-1a antikoerper, aph-1 homolog A, gamma-secretase subunit antikoerper, aph-1 homolog A, gamma secretase subunit L homeolog antikoerper, aph-1 homolog A, gamma secretase subunit antikoerper, anterior pharynx defective 1 homolog A (C. elegans) antikoerper, aph1 homolog A, gamma secretase subunit antikoerper, acylamino-acid-releasing enzyme-like antikoerper, APH1A antikoerper, aph1a.L antikoerper, Aph1a antikoerper, LOC100219182 antikoerper

Hintergrund: APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

UniProt: Q96BI3

Pathways: Notch Signalweg, Neurotrophin Signalübertragung