NEDD8 Antikörper (Middle Region)

Produktnummer ABIN4886679

Produktdetails anti-NEDD8 Antikörper

Target: NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))

Bindungsspezifität: AA 20-60, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: TDKVERIKER VEEKEGIPPQ QQRLIYSGKQ MNDEKTAADY K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neural precursor cell expressed, developmentally down-regulated 8
Protein Name: NEDD8

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu NEDD8

Target: NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))

Andere Bezeichnung: NEDD8 (NEDD8 Produkte)

Synonyme: NEDD-8 antikoerper, Rub1 antikoerper, CG10679 antikoerper, Dmel\\CG10679 antikoerper, NEDD8 antikoerper, dNEDD8 antikoerper, nedd8 antikoerper, ubiquitin antikoerper, si:zc14a17.5 antikoerper, GB17785 antikoerper, DDBDRAFT_0218116 antikoerper, DDBDRAFT_0238041 antikoerper, DDB_0218116 antikoerper, DDB_0238041 antikoerper, nedd8.S antikoerper, neural precursor cell expressed, developmentally down-regulated 8 antikoerper, neural precursor cell expressed, developmentally down-regulated gene 8 antikoerper, CG10679 gene product from transcript CG10679-RB antikoerper, Nedd8 antikoerper, ubiquitin-like protein Nedd8 antikoerper, neural precursor cell expressed, developmentally down-regulated 8 L homeolog antikoerper, NEDD8 antikoerper, Nedd8 antikoerper, nedd8 antikoerper, nedd8.L antikoerper

Hintergrund: NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60 % amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.

Synonyms: NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843

Gen-ID: 4738

UniProt: Q15843

Pathways: Ubiquitin Proteasome Pathway