APC2 Antikörper (N-Term)

Produktnummer ABIN4886464

Produktdetails anti-APC2 Antikörper

Target: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Bindungsspezifität: AA 51-90, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.

Sequenz: KHLQGKLEQE ARVLVSSGQT EVLEQLKALQ MDITSLYNLK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.
Gene Name: APC2, WNT signaling pathway regulator
Protein Name: Adenomatous polyposis coli protein 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu APC2

Target: APC2 (APC Regulator of WNT Signaling Pathway 2 (APC2))

Andere Bezeichnung: APC2 (APC2 Produkte)

Synonyme: APCL antikoerper, AI852447 antikoerper, R75424 antikoerper, APC2, WNT signaling pathway regulator antikoerper, adenomatosis polyposis coli 2 antikoerper, APC2 antikoerper, Apc2 antikoerper

Hintergrund: APC2, which is also called APCL, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Synonyms: APCL | APC2 | APC 2 | O95996

Gen-ID: 10297

Pathways: WNT Signalweg