UHRF2 Antikörper (N-Term)
-
- Target Alle UHRF2 Antikörper anzeigen
- UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))
-
Bindungsspezifität
- AA 15-54, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UHRF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- TIEDVSRKAT IEELRERVWA LFDVRPECQR LFYRGKQLEN
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase UHRF2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product UHRF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))
- Andere Bezeichnung
- UHRF2 (UHRF2 Produkte)
- Synonyme
- NIRF antikoerper, RNF107 antikoerper, URF2 antikoerper, 2310065A22Rik antikoerper, AI426270 antikoerper, AW214556 antikoerper, D130071B19Rik antikoerper, Nirf antikoerper, ubiquitin like with PHD and ring finger domains 2 antikoerper, ubiquitin-like, containing PHD and RING finger domains 2 antikoerper, ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase L homeolog antikoerper, UHRF2 antikoerper, Uhrf2 antikoerper, uhrf2.L antikoerper
- Hintergrund
-
E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Synonyms: DKFZp434B0920 antibody|DKFZp686G0837 antibody|E3 ubiquitin-protein ligase UHRF2 antibody|MGC33463 antibody|Np95 like RING finger protein antibody|Np95-like ring finger protein antibody|Np95/ICBP90 like RING finger protein antibody|Np95/ICBP90-like RING finger protein antibody|Nuclear protein 97 antibody|Nuclear zinc finger protein Np97 antibody|RING finger protein 107 antibody|RNF 107 antibody|RP11-472F14.2 antibody|Ubiquitin like containing PHD and RING finger domains protein 2 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody|Uhrf2 antibody| UHRF2_HUMAN antibody|URF 2 antibody - Gen-ID
- 115426
-