UHRF2 Antikörper (N-Term)

Produktnummer ABIN3044559

Produktdetails anti-UHRF2 Antikörper

Target: UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))

Bindungsspezifität: AA 15-54, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UHRF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: TIEDVSRKAT IEELRERVWA LFDVRPECQR LFYRGKQLEN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF2(UHRF2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
Protein Name: E3 ubiquitin-protein ligase UHRF2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu UHRF2

Target: UHRF2 (Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2))

Andere Bezeichnung: UHRF2 (UHRF2 Produkte)

Synonyme: NIRF antikoerper, RNF107 antikoerper, URF2 antikoerper, 2310065A22Rik antikoerper, AI426270 antikoerper, AW214556 antikoerper, D130071B19Rik antikoerper, Nirf antikoerper, ubiquitin like with PHD and ring finger domains 2 antikoerper, ubiquitin-like, containing PHD and RING finger domains 2 antikoerper, ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase L homeolog antikoerper, UHRF2 antikoerper, Uhrf2 antikoerper, uhrf2.L antikoerper

Hintergrund: E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Synonyms: DKFZp434B0920 antibody|DKFZp686G0837 antibody|E3 ubiquitin-protein ligase UHRF2 antibody|MGC33463 antibody|Np95 like RING finger protein antibody|Np95-like ring finger protein antibody|Np95/ICBP90 like RING finger protein antibody|Np95/ICBP90-like RING finger protein antibody|Nuclear protein 97 antibody|Nuclear zinc finger protein Np97 antibody|RING finger protein 107 antibody|RNF 107 antibody|RP11-472F14.2 antibody|Ubiquitin like containing PHD and RING finger domains protein 2 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody|Uhrf2 antibody| UHRF2_HUMAN antibody|URF 2 antibody

Gen-ID: 115426